HPA018492

PDE1B antibody from Sigma-Aldrich
PDES1B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018492
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018492, RRID:AB_1855119
Product name
Anti-PDE1B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018492
Antibody type
Polyclonal
Antigen
Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPS
LDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAA
SGITNQMSIDELSPCEEEAPPSPAEDEHNQNGN
Storage
-20C
Provider Type Product Number
- No reagents -