HPA017203

CRABP1 antibody from Sigma-Aldrich
CRABP, CRABP-I, CRABPI, RBP5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017203
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017203, RRID:AB_1846512
Product name
Anti-CRABP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017203
Antibody type
Polyclonal
Antigen
Cellular retinoic acid-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRS
LATWENENKIHCTQTLLEGDGPKTYWTRELANDEL
ILTFGADDVVCTRIYVRE
Storage
-20C
Provider Type Product Number
- No reagents -