Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA017203 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA017203, RRID:AB_1846512
- Product name
- Anti-CRABP1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRS
LATWENENKIHCTQTLLEGDGPKTYWTRELANDEL
ILTFGADDVVCTRIYVRE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references CRABP1 provides high malignancy of transformed mesenchymal cells and contributes to the pathogenesis of mesenchymal and neuroendocrine tumors.
Kainov Y, Favorskaya I, Delektorskaya V, Chemeris G, Komelkov A, Zhuravskaya A, Trukhanova L, Zueva E, Tavitian B, Dyakova N, Zborovskaya I, Tchevkina E
Cell cycle (Georgetown, Tex.) 2014;13(10):1530-9
Cell cycle (Georgetown, Tex.) 2014;13(10):1530-9
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human vagina shows cytoplasmic and nuclear positivity in squamous epithelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human retina shows cytoplasmic positivity in cells in inner nuclear layer and nerve fibers.
- Sample type
- HUMAN