Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN2739830 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cyclin-Dependent Kinase 5, Regulatory Subunit 1 (p35) (CDK5R1) (AA 11-44), (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide from the N-terminus of human CDK5R1 (aa11-44, YRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRH), identical to the related mouse and rat sequences. Percent identity by BLAST analysis: Human, Galago, Marmoset, Mouse, Ferret, Bovine, Bat, Horse, Gui ...ImmunogenType: Synthetic peptide
- Description
- Immunoaffinity purified
- Reactivity
- Human
- Host
- Rabbit
- Epitope
- AA 11-44,N-Term
- Isotype
- IgG
- Vial size
- 100 μg
- Storage
- Short term 4°C, long term aliquot and store at -20°C, .
- Handling
- avoid freeze thaw cycles
No comments: Submit comment
No validations: Submit validation data