Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- LS-C388251 - Provider product page
- Provider
- LSBio
- Product name
- Anti-CDK5R1 Antibody (aa11-44) LS-C388251
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide from the N-terminus of human CDK5R1 (YRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRH, aa11-44 of NP_003876.1). Percent identity by BLAST analysis: Human, Mouse, Rat, Ferret, Sheep, Bovine, Bat, Horse, Guinea pig, Dog (100%); Elephant, Pig (97%); Opossum, Trout, Medaka, Seabass, Zebrafish, Stickleback (94%); Pufferfish (84%).
- Description
- Immunoaffinity purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Horse, Sheep
- Host
- Rabbit
- Isotype
- IgG
- Vial size
- 0.2ml
- Storage
- Prior to reconstitution, +4°C. Following reconstitution store at -20°C. Avoid freeze-thaw cycles.
No comments: Submit comment
No validations: Submit validation data