Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502316 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-GTP-Binding Protein 10 (Putative) (GTPBP10) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GTPBP10 antibody: synthetic peptide directed towards the middle region of human GTPBP10
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Zebrafish
- Host
- Rabbit
- Antigen sequence
IILLTKELELYKEELQTKPALLAVNKMDLPDAQDK
FHELM SQLQNPKDFL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Human small G proteins, ObgH1, and ObgH2, participate in the maintenance of mitochondria and nucleolar architectures.
Hirano Y, Ohniwa RL, Wada C, Yoshimura SH, Takeyasu K
Genes to cells : devoted to molecular & cellular mechanisms 2006 Nov;11(11):1295-304
Genes to cells : devoted to molecular & cellular mechanisms 2006 Nov;11(11):1295-304
No comments: Submit comment
No validations: Submit validation data