HPA021076

GTPBP10 antibody from Sigma-Aldrich
DKFZP686A10121, FLJ38242
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021076
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021076, RRID:AB_1850411
Product name
Anti-GTPBP10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021076
Antibody type
Polyclonal
Antigen
GTP-binding protein 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALKGSKGKDCEIPVPVGISVTDENGKIIGELNKEN
DRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLI
ADVGLVGFPNAGKSSLLSCVSHAKPAIADYAF
Storage
-20C
Provider Type Product Number
- No reagents -