HPA026887

SLC25A26 antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026887
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026887, RRID:AB_2189921
Product name
Anti-SLC25A26
Provider product page
Atlas Antibodies - HPA026887
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SAGEVVACLIRVPSEVVKQRAQVSASTRTFQIFSN
ILYEEGIQGLYRGYKSTVLREIPFSLVQFPLWESL
KALWSWRQDHVVDSWQSAVCGAFAGGFAAAVTTPL
DVAKTRITLAKAGSSTADGNVLSVLHGV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -