H00083661-B01P

MS4A8 antibody from Abnova Corporation
CD20L5, MS4A4, MS4A8B

Antibody data

Product number
H00083661-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00083661-B01P, RRID:AB_1138684
Product name
MS4A8B purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00083661-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MS4A8B protein.
Antigen sequence
MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPL
YPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGK
TLGAIQIIIGLARIGLGSIMATVLVGEYLSISFYG
GFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLG
LNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYA
WGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLV
CCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSE
IQANK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -