H00083661-M04

MS4A8 antibody from Abnova Corporation
CD20L5, MS4A4, MS4A8B
No application information provided.

Antibody data

Product number
H00083661-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00083661-M04, RRID:AB_1577453
Product name
MS4A8B monoclonal antibody (M04), clone 1B4
Provider product page
Abnova Corporation - H00083661-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MS4A8B.
Antigen sequence
MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPL
YPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGK
TLGAIQIIIGLARIGLGSIMATVLVGEYLSISFYG
GFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLG
LNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYA
WGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLV
CCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSE
IQANK
Isotype
IgG
Antibody clone number
1B4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -