HPA007319

MS4A8 antibody from Atlas Antibodies
CD20L5, MS4A4, MS4A8B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007319
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007319, RRID:AB_1234884
Product name
Anti-MS4A8
Provider product page
Atlas Antibodies - HPA007319
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EFGIACASSHFGCQLVCCQSSNVSVIYPNIYAANP
VITPEPVTSPPSYSSEIQANK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -