HPA007318

MS4A8 antibody from Sigma-Aldrich
CD20L5, MS4A4, MS4A8B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007318
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007318, RRID:AB_1854139
Product name
Anti-MS4A8B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007318
Antibody type
Polyclonal
Antigen
Membrane-spanning 4-domains subfamily A member 8B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPL
YPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGK
Storage
-20C
Provider Type Product Number
- No reagents -