Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501825 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Neurogenic Differentiation 4 (NEUROD4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NEUROD4 antibody: synthetic peptide directed towards the middle region of human NEUROD4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
PHYPSSSLSSGHVHSTPFQAGTPRYDVPIDMSYDS
YPHHG IGTQLNTVFT- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references beta-cell transcription factors and diabetes: no evidence for diabetes-associated mutations in the gene encoding the basic helix-loop-helix transcription factor neurogenic differentiation 4 (NEUROD4) in Japanese patients with MODY.
Horikawa Y, Horikawa Y, Cox NJ, Iwasaki N, Ogata M, Iwamoto Y, Schwitzgebel V, German MS, Bell GI
Diabetes 2000 Nov;49(11):1955-7
Diabetes 2000 Nov;49(11):1955-7
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting