HPA026998

NEUROD4 antibody from Sigma-Aldrich
ATH-3, Atoh3, bHLHa4, MATH-3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026998
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026998, RRID:AB_1854394
Product name
Anti-NEUROD4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026998
Antibody type
Polyclonal
Antigen
Neurogenic differentiation factor 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLLEKHEDKSPICDSAISVHNFNYQSPGLPSPPYG
HMETHLLHLKPQVFKSLGESSFGSHLPDCSTPPYE
GPLTPPLSISGNFSLKQDGSPDLEKSYSFMPHYPS
SSLSSGHVHSTPFQAGTPRYDVPIDMSYDSYPHHG
IGTQLNTVFT
Storage
-20C
Provider Type Product Number
- No reagents -