HPA007261

KRT9 antibody from MilliporeSigma / Merck KGaA
CK-9, EPPK, K9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007261
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA007261, RRID:AB_1079182
Product name
Anti-KRT9 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA007261
Antibody type
Polyclonal
Antigen
Keratin, type I cytoskeletal 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEEMSQLTGQNSGDVNVEINVAPGKDLTKTLNDMR
QEYEQLIAKNRKDIENQYETQITQIEHEVSSSGQE
VQSSAKEVTQLRHGVQELEIELQSQLSKKAALEKS
LE
Storage
-20C
Provider Type Product Number
- No reagents -