HPA009673

KRT9 antibody from Sigma-Aldrich
CK-9, EPPK, K9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009673
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009673, RRID:AB_1852251
Product name
Anti-KRT9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009673
Antibody type
Polyclonal
Antigen
Keratin, type I cytoskeletal 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NNDLENKIQDWYDKKGPAAIQKNYSPYYNTIDDLK
DQIVDLTVGNNKTLLDIDNTRMTLDDFRIKFEMEQ
NLRQGVDADINGLRQVLDNLTMEKSDLEMQYETLQ
EELMALKKN
Storage
-20C
Provider Type Product Number
- No reagents -