HPA007305

CALB2 antibody from Sigma-Aldrich
CAL2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007305
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007305, RRID:AB_1078386
Product name
Anti-CALB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007305
Antibody type
Polyclonal
Antigen
Calretinin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLN
GDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFN
AIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMN
IQQLTNYRKSVMSLAEAGKLYRKDLEIV
Storage
-20C
Provider Type Product Number
- No reagents -