ABIN183194
antibody from antibodies-online
Targeting: PITX2
ARP1, Brx1, IGDS, IHG2, IRID2, Otlx2, RGS, RIEG, RIEG1, RS
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183194 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Paired-Like Homeodomain 2 (PITX2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PITX2 antibody: synthetic peptide directed towards the N terminal of human PITX2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
SAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRL
EVHTI SDTSSPEAAE- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Functional corneal endothelium derived from corneal stroma stem cells of neural crest origin by retinoic acid and Wnt/β-catenin signaling.
PITX2 is required for normal development of neurons in the mouse subthalamic nucleus and midbrain.
Hatou S, Yoshida S, Higa K, Miyashita H, Inagaki E, Okano H, Tsubota K, Shimmura S
Stem cells and development 2013 Mar 1;22(5):828-39
Stem cells and development 2013 Mar 1;22(5):828-39
PITX2 is required for normal development of neurons in the mouse subthalamic nucleus and midbrain.
Martin DM, Skidmore JM, Philips ST, Vieira C, Gage PJ, Condie BG, Raphael Y, Martinez S, Camper SA
Developmental biology 2004 Mar 1;267(1):93-108
Developmental biology 2004 Mar 1;267(1):93-108
No comments: Submit comment
No validations: Submit validation data