HPA010010

RPS6KB2 antibody from Atlas Antibodies
KLS, P70-BETA, p70S6Kb, S6K?, S6KB, S6Kbeta, STK14B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010010
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010010, RRID:AB_1856469
Product name
Anti-RPS6KB2
Provider product page
Atlas Antibodies - HPA010010
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGF
SFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSP
SLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -