HPA010010

RPS6KB2 antibody from Sigma-Aldrich
KLS, P70-BETA, p70S6Kb, STK14B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010010
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010010, RRID:AB_1856469
Product name
Anti-RPS6KB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010010
Antibody type
Polyclonal
Antigen
Ribosomal protein S6 kinase beta-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGF
SFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSP
SLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK
Storage
-20C
Provider Type Product Number
- No reagents -