HPA023633

SPACA3 antibody from Atlas Antibodies
ALLP17, CT54, LYC3, LYZL3, SLLP1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023633
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023633, RRID:AB_1857407
Product name
Anti-SPACA3
Provider product page
Atlas Antibodies - HPA023633
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNP
NLKDTVICAMKITQEPQGLGYWEAWRHHCQGKDLT
EWVDGCDF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -