HPA023633

SPACA3 antibody from Sigma-Aldrich
ALLP17, CT54, LYC3, LYZL3, SLLP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023633
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023633, RRID:AB_1857407
Product name
Anti-SPACA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023633
Antibody type
Polyclonal
Antigen
Sperm acrosome membrane-associated protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNP
NLKDTVICAMKITQEPQGLGYWEAWRHHCQGKDLT
EWVDGCDF
Storage
-20C
Provider Type Product Number
- No reagents -