HPA015267

CDK14 antibody from Sigma-Aldrich
PFTAIRE1, PFTK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015267
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015267, RRID:AB_1855249
Product name
Anti-PFTK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015267
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase PFTAIRE-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDK
KVRVQRTQSTFDPFEKPANQVKRVHSENNACINFK
TSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLE
KLGEGSYATVYKGKSKVNG
Storage
-20C
Provider Type Product Number
- No reagents -