HPA015267

CDK14 antibody from Atlas Antibodies
PFTAIRE1, PFTK1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015267
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015267, RRID:AB_1855249
Product name
Anti-CDK14
Provider product page
Atlas Antibodies - HPA015267
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDK
KVRVQRTQSTFDPFEKPANQVKRVHSENNACINFK
TSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLE
KLGEGSYATVYKGKSKVNG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -