H00221687-M03

RNF182 antibody from Abnova Corporation
MGC33993
No application information provided.

Antibody data

Product number
H00221687-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00221687-M03, RRID:AB_1137425
Product name
RNF182 monoclonal antibody (M03), clone 2D8
Provider product page
Abnova Corporation - H00221687-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RNF182.
Antigen sequence
MASQPPEDTAESQASDELECKICYNRYNLKQRKPK
VLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFE
TCLPDDEVSSLPDDNNILVNLTCGGKGKK
Isotype
IgG
Antibody clone number
2D8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -