HPA012309

RNF182 antibody from Sigma-Aldrich
MGC33993
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012309
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012309, RRID:AB_1856349
Product name
Anti-RNF182 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012309
Antibody type
Polyclonal
Antigen
RING finger protein 182 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFE
TCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENP
TELLLTPKRLASLVSPSHTSSNCLVITIMEVQRES
SPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTS
LL
Storage
-20C
Provider Type Product Number
- No reagents -