HPA019460

EOGT antibody from Sigma-Aldrich
AER61, C3orf64, FLJ33770
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019460
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019460, RRID:AB_1844628
Product name
Anti-C3orf64 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019460
Antibody type
Polyclonal
Antigen
Uncharacterized glycosyltransferase AER61 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NEAPPNTHSIPGEPLYNYASIRLPEEHIPFFLHNN
RHIATVCRKDSLCPYKKHLEKLKYCWGYEKSCKPE
FRFGYPVCSYVDMGWTDTLESAEDIFWKQADFGYA
RERLEEMHVLCQPKETSDSSLVCSRYLQ
Storage
-20C
Provider Type Product Number
- No reagents -