Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00116085-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00116085-M02, RRID:AB_1581733
- Product name
- SLC22A12 monoclonal antibody (M02), clone 2B5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SLC22A12.
- Antigen sequence
ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTL
TPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR- Isotype
- IgG
- Antibody clone number
- 2B5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references OIT3 deficiency impairs uric acid reabsorption in renal tubule.
Sucrose induces fatty liver and pancreatic inflammation in male breeder rats independent of excess energy intake.
Yan B, Zhang ZZ, Huang LY, Shen HL, Han ZG
FEBS letters 2012 Mar 23;586(6):760-5
FEBS letters 2012 Mar 23;586(6):760-5
Sucrose induces fatty liver and pancreatic inflammation in male breeder rats independent of excess energy intake.
Roncal-Jimenez CA, Lanaspa MA, Rivard CJ, Nakagawa T, Sanchez-Lozada LG, Jalal D, Andres-Hernando A, Tanabe K, Madero M, Li N, Cicerchi C, Mc Fann K, Sautin YY, Johnson RJ
Metabolism: clinical and experimental 2011 Sep;60(9):1259-70
Metabolism: clinical and experimental 2011 Sep;60(9):1259-70
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SLC22A12 monoclonal antibody (M02), clone 2B5. Western Blot analysis of SLC22A12 expression in human stomach.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SLC22A12 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol