HPA024575

SLC22A12 antibody from Sigma-Aldrich
OAT4L, RST, URAT1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024575
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024575, RRID:AB_1858650
Product name
Anti-SLC22A12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024575
Antibody type
Polyclonal
Antigen
Solute carrier family 22 member 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTL
TPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRT
CI
Storage
-20C
Provider Type Product Number
- No reagents -