Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [8]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007308 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA007308, RRID:AB_1079501
- Product name
- Anti-NQO1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPI
QSGILHFCGFQVLEPQLTYSIGHTPADARIQILEG
WKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKE
VQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references NRF2 regulates serine biosynthesis in non–small cell lung cancer
Exome sequencing of hepatocellular carcinomas identifies new mutational signatures and potential therapeutic targets.
Integrated transcriptomic and proteomic analyses uncover regulatory roles of Nrf2 in the kidney.
Idebenone protects against retinal damage and loss of vision in a mouse model of Leber's hereditary optic neuropathy.
DeNicola G, Chen P, Mullarky E, Sudderth J, Hu Z, Wu D, Tang H, Xie Y, Asara J, Huffman K, Wistuba I, Minna J, DeBerardinis R, Cantley L
Nature Genetics 2015 October;47(12):1475-1481
Nature Genetics 2015 October;47(12):1475-1481
Exome sequencing of hepatocellular carcinomas identifies new mutational signatures and potential therapeutic targets.
Schulze K, Imbeaud S, Letouzé E, Alexandrov LB, Calderaro J, Rebouissou S, Couchy G, Meiller C, Shinde J, Soysouvanh F, Calatayud AL, Pinyol R, Pelletier L, Balabaud C, Laurent A, Blanc JF, Mazzaferro V, Calvo F, Villanueva A, Nault JC, Bioulac-Sage P, Stratton MR, Llovet JM, Zucman-Rossi J
Nature genetics 2015 May;47(5):505-511
Nature genetics 2015 May;47(5):505-511
Integrated transcriptomic and proteomic analyses uncover regulatory roles of Nrf2 in the kidney.
Shelton LM, Lister A, Walsh J, Jenkins RE, Wong MH, Rowe C, Ricci E, Ressel L, Fang Y, Demougin P, Vukojevic V, O'Neill PM, Goldring CE, Kitteringham NR, Park BK, Odermatt A, Copple IM
Kidney international 2015 Dec;88(6):1261-1273
Kidney international 2015 Dec;88(6):1261-1273
Idebenone protects against retinal damage and loss of vision in a mouse model of Leber's hereditary optic neuropathy.
Heitz FD, Erb M, Anklin C, Robay D, Pernet V, Gueven N
PloS one 2012;7(9):e45182
PloS one 2012;7(9):e45182
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines A-549 and HEK293 using Anti-NQO1 antibody. Corresponding NQO1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human stomach and lymph node tissues using HPA007308 antibody. Corresponding NQO1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows no positivity in non - germinal center cells as expected.
- Sample type
- HUMAN