HPA007308

NQO1 antibody from Sigma-Aldrich
DHQU, DIA4, DTD, NMOR1, QR1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007308
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007308, RRID:AB_1079501
Product name
Anti-NQO1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007308
Antibody type
Polyclonal
Antigen
NAD(P)H dehydrogenase [quinone] 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPI
QSGILHFCGFQVLEPQLTYSIGHTPADARIQILEG
WKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKE
VQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR
Storage
-20C
Provider Type Product Number
- No reagents -