PAB21261

ZNF592 antibody from Abnova Corporation
CAMOS, KIAA0211, SCAR5

Antibody data

Product number
PAB21261
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21261, RRID:AB_10965215
Product name
ZNF592 polyclonal antibody
Provider product page
Abnova Corporation - PAB21261
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ZNF592.
Antigen sequence
EVPVEEHFPEAGTNSGSPQGARKGDESMTKASDSS
SPSCSSGPRVPKGAAPGSQTGKKQQSTALQASTLA
PANLLPKAVHLANLNLVPHSVAASVTAKSSVQRRS
QP
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -