HPA021600

ZNF592 antibody from Sigma-Aldrich
CAMOS, KIAA0211, SCAR5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021600
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021600, RRID:AB_1859364
Product name
Anti-ZNF592 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021600
Antibody type
Polyclonal
Antigen
Zinc finger protein 592 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LARELGTCSSVPPRQRLKPAHSKLSSCVAALVALQ
AKRVASVTKEDQPGHTKDLSGPTKESSKGSPKMPK
SPKSPRSPLEATRKSIKPSDSPRSICSDSSSKGSP
SVAASS
Storage
-20C
Provider Type Product Number
- No reagents -