H00006357-M02

CCL13 antibody from Abnova Corporation
CKb10, MCP-4, MGC17134, NCC-1, SCYA13, SCYL1
ELISA
Recommended by provider

Antibody data

Product number
H00006357-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006357-M02, RRID:AB_1572677
Product name
CCL13 monoclonal antibody (M02), clone S1
Provider product page
Abnova Corporation - H00006357-M02
Antibody type
Monoclonal
Antigen
CCL13 (AAH08621, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Description
Mouse monoclonal antibody raised against a full length recombinant CCL13.
Reactivity
Human
Host
Mouse
Antigen sequence
MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCC
FTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLG
KEICADPKEKWVQNYMKHLGRKAHTLKT
Isotype
IgG
Vial size
100 μg
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -