H00006357-M03

CCL13 antibody from Abnova Corporation
CKb10, MCP-4, MGC17134, NCC-1, SCYA13, SCYL1
No application information provided.

Antibody data

Product number
H00006357-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006357-M03, RRID:AB_1572679
Product name
CCL13 monoclonal antibody (M03), clone S2
Provider product page
Abnova Corporation - H00006357-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant CCL13.
Antigen sequence
MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCC
FTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLG
KEICADPKEKWVQNYMKHLGRKAHTLKT
Isotype
IgG
Antibody clone number
S2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -