PAB28640
antibody from Abnova Corporation
Targeting: PSMA6
IOTA, MGC22756, MGC2333, MGC23846, p27K, PROS27
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28640 - Provider product page

- Provider
- Abnova Corporation
- Product name
- PSMA6 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant PSMA6.
- Antigen sequence
EAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEM
RPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKAT
AAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC
LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEID
AHL- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: Human cell line RT-4, Lane 2: Human cell line U-251MG sp with PSMA6 polyclonal antibody (Cat # PAB28640) at 1:100-1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-251MG with PSMA6 polyclonal antibody (Cat # PAB28640) at 1-4 ug/ml shows positivity in nucleus but not nucleoli & cytoplasm.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human urinary bladder with PSMA6 polyclonal antibody (Cat # PAB28640) shows strong nuclear and cytoplasmic positivity in urothelial cells at 1:500-1:1000 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)