ABIN633332

antibody from antibodies-online

Targeting: PSMA6 IOTA, MGC22756, MGC2333, MGC23846, p27K, PROS27

Western blot

Antibody data

Submit

Validation data

Product number: ABIN633332 - Provider product page
Provider: antibodies-online
Product name: anti-Proteasome (Prosome, Macropain) Subunit, alpha Type, 6 (PSMA6) antibody
Antibody type: Polyclonal
Antigen: PSMA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITEN
Description: Affinity purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

PSMA6 protein structure - ABIN633332 shown in red.