ABIN310030
antibody from antibodies-online
Targeting: PSMA6
IOTA, MGC22756, MGC2333, MGC23846, p27K, PROS27
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310030 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Proteasome (Prosome, Macropain) Subunit, alpha Type, 6 (PSMA6) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PSMA6 antibody: synthetic peptide directed towards the N terminal of human PSMA6
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
EYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSST VTHLFKITEN- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The exon 1-8C/G SNP in the PSMA6 gene contributes only a small amount to the burden of myocardial infarction in 6946 cases and 2720 controls from a United Kingdom population.
Bennett DA, Xu P, Clarke R, Zondervan K, Parish S, Palmer A, Cardon L, Peto R, Lathrop M, Collins R, International Study of Infarct Survival Collaborators
European journal of human genetics : EJHG 2008 Apr;16(4):480-6
European journal of human genetics : EJHG 2008 Apr;16(4):480-6
No comments: Submit comment
No validations: Submit validation data