HPA003049

PSMA6 antibody from Atlas Antibodies
IOTA, MGC22756, MGC2333, MGC23846, p27K, PROS27
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003049
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003049, RRID:AB_611726
Product name
Anti-PSMA6
Provider product page
Atlas Antibodies - HPA003049
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEM
RPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKAT
AAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC
LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEID
AHL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -