HPA003049

PSMA6 antibody from Sigma-Aldrich
IOTA, MGC22756, MGC2333, MGC23846, p27K, PROS27
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003049
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003049, RRID:AB_1079703
Product name
Anti-PSMA6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003049
Antibody type
Polyclonal
Antigen
Proteasome subunit-alpha type 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEM
RPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKAT
AAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC
LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEID
AHL
Storage
-20C
Provider Type Product Number
- No reagents -