HPA007266

CAMK1D antibody from Sigma-Aldrich
CKLiK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007266
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007266, RRID:AB_1078389
Product name
Anti-CAMK1D antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007266
Antibody type
Polyclonal
Antigen
Calcium/calmodulin-dependent protein kinase type 1D recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFS
EVVLAEEKATGKLFAVKCIPKKALKGKESSIENEI
AVLRKIKHENIVALEDIYESPNHLYLVMQLVSGG
Storage
-20C
Provider Type Product Number
- No reagents -