Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006346-D01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006346-D01P, RRID:AB_1572223
- Product name
- CCL1 purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human CCL1 protein.
- Antigen sequence
MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCF
SFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGK
EACALDTVGWVQRHRKMLRHCPSKRK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Toxin-induced RhoA activity mediates CCL1-triggered signal transducers and activators of transcription protein signaling.
Reipschläger S, Kubatzky K, Taromi S, Burger M, Orth J, Aktories K, Schmidt G
The Journal of biological chemistry 2012 Mar 30;287(14):11183-94
The Journal of biological chemistry 2012 Mar 30;287(14):11183-94
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CCL1 expression in transfected 293T cell line (H00006346-T01) by CCL1 MaxPab polyclonal antibody.Lane 1: CCL1 transfected lysate(11.00 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CCL1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CCL1 expression in A-431.