AV33408

TCEA2 antibody from Sigma-Aldrich
TFIIS
No application information provided.

Antibody data

Product number
AV33408
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV33408, RRID:AB_1857828
Product name
Anti-TCEA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV33408
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human TCEA2 with an internal ID of P04454
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
AMPITLHLLQSTRVGMSVNALRKQSSDEEVIALAK
SLIKSWKKLLDASDA
Storage
-20C
Provider Type Product Number
- No reagents -