HPA007973

S100A4 antibody from Atlas Antibodies
18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98

Antibody data

Product number
HPA007973
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007973, RRID:AB_1079858
Product name
Anti-S100A4
Provider product page
Atlas Antibodies - HPA007973
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELK
ELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEV
DFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.