HPA007973

S100A4 antibody from Sigma-Aldrich
18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007973
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007973, RRID:AB_1079858
Product name
Anti-S100A4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007973
Antibody type
Polyclonal
Antigen
Protein S100-A4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELK
ELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEV
DFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Storage
-20C
Provider Type Product Number
- No reagents -