HPA027211

ZNF830 antibody from Atlas Antibodies
CCDC16, MGC20398, OMCG1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027211
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027211, RRID:AB_1859465
Product name
Anti-ZNF830
Provider product page
Atlas Antibodies - HPA027211
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GSSASSAPQSVKRKAPDADDQDVKRAKATLVPQVQ
PSTSAWTTNFDKIGKEFIRATPSKPSGLSLLPDYE
DEEEEEEEEEGDGER
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -