HPA024754

ZNF830 antibody from Sigma-Aldrich
CCDC16, MGC20398, OMCG1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024754
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024754, RRID:AB_1859464
Product name
Anti-ZNF830 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024754
Antibody type
Polyclonal
Antigen
Zinc finger protein 830 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QGKEHSVSSSREVTSSVLPNDFFSTNPPKAPIIPH
SGSIEKAEIHEKVVERRENTAEALPEGFFDDPEVD
ARVRKVDAPKDQM
Storage
-20C
Provider Type Product Number
- No reagents -