HPA021381

BLOC1S1 antibody from Atlas Antibodies
BLOS1, BORCS1, GCN5L1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021381
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021381, RRID:AB_2228026
Product name
Anti-BLOC1S1
Provider product page
Atlas Antibodies - HPA021381
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLKEHQAKQNERKELQEKRRREAITAATCLTEALV
DHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQT
GQWIGMVENFNQALKEIGDVENWARSIELDMRTIA
TALEYVYKGQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -