PAB21399

BLOC1S1 antibody from Abnova Corporation
BLOS1, BORCS1, GCN5L1

Antibody data

Product number
PAB21399
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21399, RRID:AB_10983326
Product name
BLOC1S1 polyclonal antibody
Provider product page
Abnova Corporation - PAB21399
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant BLOC1S1.
Antigen sequence
LLKEHQAKQNERKELQEKRRREAITAATCLTEALV
DHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQT
GQWIGMVENFNQALKEIGDVENWARSIELDMRTIA
TALEYVYKGQ
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -