Antibody data

Product number
H00000307-M13
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000307-M13, RRID:AB_1136887
Product name
ANXA4 monoclonal antibody (M13), clone 1D3
Provider product page
Abnova Corporation - H00000307-M13
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ANXA4.
Antigen sequence
MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTD
EDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDL
KSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAG
TDEGCLIEILASRTPEEIRRISQTYQQQYGRSLED
DIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQ
DAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHV
FDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCM
RNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEI
DMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLV
LCGGDD
Isotype
IgG
Antibody clone number
1D3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -